DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and APPL2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:395 Identity:79/395 - (20%)
Similarity:122/395 - (30%) Gaps:136/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VHRNL---GVHLTFVRSTNLDTNWTWLQLRQMQLGGN-------ANAAQFFR-AHNCSTTDAQVK 108
            ::|||   ..:|.....|.|.|. ||.:|.....|||       |.|....: ..|||.      
Human   279 INRNLIQKAGYLNLRNKTGLVTT-TWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSV------ 336

  Fly   109 YNSRAAQLYRDKLCAQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNVS 173
               .|......:.|.|........|..|..|...::|                  ::....||:|
Human   337 ---MAVDCEDRRYCFQITTPNGKSGIILQAESRKENE------------------EWICAINNIS 380

  Fly   174 KQ---DPNPPTVA------------PVISV-ETQQGGAPSVNLLNS--------VVPAAVPS--- 211
            :|   ..||..||            |:.|. :.|:...||.||.||        :||.|..|   
Human   381 RQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNSEMENENDKIVPKATASLPE 445

  Fly   212 -------------------------SIGARKVQPKKGGLGARK-----------------VGGLG 234
                                     :.|:|:..|    .|..:                 |..||
Human   446 AEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNP----FGETEDESFPEAEDSLLQQMFIVRFLG 506

  Fly   235 ATKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQELSMQKTREEAKLK 299
            :..|||: :..|....|..::..:.|...:.: .|....:.|..|:||.  :...|.:|...:|.
Human   507 SMAVKTD-STTEVIYEAMRQVLAARAIHNIFR-MTESHLMVTSQSLRLI--DPQTQVSRANFELT 567

  Fly   300 TMDPAKAKQMERLGMGF--------------------NLRGSDMAHSALGDMETIQQSAAPKAKL 344
            ::....|.|..:..:||                    |..|..:.::.....|.|:....|:|..
Human   568 SVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALA 632

  Fly   345 SLLES 349
            .|:.|
Human   633 QLMLS 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 19/76 (25%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316
BAR-PH_APPL 258..382 CDD:270067 28/130 (22%)
PTB_APPL 488..621 CDD:269980 23/136 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.