DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and zgc:92360

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001002715.1 Gene:zgc:92360 / 436988 ZFINID:ZDB-GENE-040718-470 Length:377 Species:Danio rerio


Alignment Length:320 Identity:70/320 - (21%)
Similarity:116/320 - (36%) Gaps:66/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLGG 87
            :|.|.||.||.|..|.|.|.:.|:|||:.||.|||::.. :..|:|..| :.|...:::.:...|
Zfish    17 KPGNGSCADCGADNPEWGSCSLGVFICLACSGVHRSIPT-IGKVKSLRL-SRWEDSEVQFLSECG 79

  Fly    88 NANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMKTHGTKLHLEQTDKSEGNEAARE 152
            |               |........|..:|..|...:..|.:|....:...|:.:.:|..:....
Zfish    80 N---------------DLMKAVYEAAVPVYYYKPTHRDCQVLKEQWIRAKYERQEFTEVGKKLTY 129

  Fly   153 EDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSIGARK 217
            ||     ::.....::....:.|..|...|..|     ::|.......|::..|.|:      .|
Zfish   130 ED-----ESRDGMLMKRGRDNGQFLNRRFVLSV-----REGILKYYTKLDAKEPKAL------MK 178

  Fly   218 VQPKKGGLGARKVG---GLGATKVKTNFA-DIEARANAANEMKTSAAAAPVVKPQTAEDELETVA 278
            |..........|:|   ||..|.:|.|.. :|....:::.|:               .|...::.
Zfish   179 VDTLNACFQPDKIGNPNGLQITYIKDNITRNIFVYHDSSKEI---------------VDWFNSIR 228

  Fly   279 SMRLAY----------QELSMQKTREEAKLKTMDPAKAKQMERLGMGFNLRGSDMAHSAL 328
            :.:|.|          .||..:.||...|...|:....:|.|    ||..|...:.|..|
Zfish   229 AAQLHYLKVAFPGATDAELKPKLTRSFLKEGYMEKTGPRQTE----GFKKRWFTLDHRRL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 28/97 (29%)
zgc:92360NP_001002715.1 ArfGap 8..124 CDD:279720 33/123 (27%)
PH1_ADAP 132..240 CDD:270072 22/133 (17%)
PH 134..230 CDD:278594 20/121 (17%)
PH2_ADAP 254..359 CDD:241282 9/35 (26%)
PH 257..358 CDD:278594 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.