DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and adap1l

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_989286.1 Gene:adap1l / 394901 XenbaseID:XB-GENE-5779570 Length:376 Species:Xenopus tropicalis


Alignment Length:348 Identity:90/348 - (25%)
Similarity:136/348 - (39%) Gaps:73/348 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            |.|:..|.:|.||.|..|.|:|.|.|||:|:|||.:|||| ..::.|:|..:| ||...|::.:.
 Frog    15 LTAREGNGTCADCRAPDPQWASPTLGIFLCVDCSGIHRNL-PEISKVKSLIMD-NWDDTQVQFLA 77

  Fly    85 LGGNANAAQFFRAH------NCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMKTHGTKLHLEQTDK 143
            ..||..|...:.||      ....||..|    ...|..|.|.  :.::.:|..|   ::....|
 Frog    78 SHGNIAAKAIYEAHVPVYYYRPKHTDCHV----LREQWIRSKY--ERKEFIKPKG---NISNGSK 133

  Fly   144 SEGNEAAREED---------FFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQQGGAPSVN 199
             |||...|..|         |.::.|..:.:      .:|.|...|..  ||.::|       ||
 Frog   134 -EGNLLKRGRDNGQYLPRKFFLSEIDGTLKY------FTKPDAKEPKT--VIRIDT-------VN 182

  Fly   200 LLNSVVPAAVPSSIGARKVQPKKGGLGARKVGGLGATKVKTN-FADIEARANAANEMKTSAAAAP 263
                            ...||.|    .:...||..|.||.| ..:|....|...|:.:...|. 
 Frog   183 ----------------ASFQPVK----MKNANGLQITYVKDNKTRNIFVYHNDGQEIVSWFNAI- 226

  Fly   264 VVKPQTAEDELETVASMRLAYQELSMQKTREEAKLKTMDPAKAKQMERLGMGFNLRGSDMAHSAL 328
                ::|:.....:|..:.:.:|:..:.||...|...|:....||.:    ||..|...:.|..|
 Frog   227 ----RSAQFSYMQIAFPKASDKEIISRLTRNFLKEGYMEKTGPKQTD----GFKKRWFTLDHRRL 283

  Fly   329 GDMETIQQSAAPKAKLSLLESEN 351
            ...:. ...|..|.:|.|..|:|
 Frog   284 MYFKD-PLDAFAKGELFLGSSQN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 38/106 (36%)
adap1lNP_989286.1 ArfGap 12..124 CDD:307528 39/116 (34%)
PH1_ADAP 131..239 CDD:270072 31/148 (21%)
PH2_ADAP 253..359 CDD:241282 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.