DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and ArfGAP1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster


Alignment Length:571 Identity:139/571 - (24%)
Similarity:207/571 - (36%) Gaps:176/571 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPAAGPSKQEIESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTF 65
            ||||       ....|...|:.|..|..||:|....|.|.||||||:||::||..||:|||||:|
  Fly     1 MASP-------RTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSF 58

  Fly    66 VRSTNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQV--KYNSRAAQLYRDKLCAQAQQA 128
            |||..:| .|..::|.:|:.|||.||.:|..........|.:  :|||:||.|||||:...||  
  Fly    59 VRSVTMD-KWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ-- 120

  Fly   129 MKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQQG 193
                |....|::.....|:            :|.......:|:..:..|:          .|..|
  Fly   121 ----GKSWDLKEAQGRVGS------------NNSFSSGGSSNSSYQSRPS----------ATGYG 159

  Fly   194 GAPSVNLLNSVVPAA---------------------VPSSIGARKVQPKKGGLGARKVGGLGATK 237
            |...........|..                     |.::.....:.|.:||    |..|.|.|:
  Fly   160 GNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGG----KYAGFGFTR 220

  Fly   238 ---VKTNFAD-----IEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQELSMQKTRE 294
               .||...:     :...|:..:...|:|:..    ..||:::..|..:       |:..|.:|
  Fly   221 EPPPKTQSQELFDSTLSTLASGWSLFSTNASKL----ASTAKEKAVTTVN-------LASTKIKE 274

  Fly   295 EAKLKTMD------PAKAKQMERLGMGFNLRGSDMAHSALGDMETIQQSAAPKAKLSLLESENFF 353
            ...|.::.      .:|...|.:.|.. ||.||:::....|                  .::..|
  Fly   275 GTLLDSVQCGVTDVASKVTDMGKRGWN-NLAGSNISSPQGG------------------YNDPNF 320

  Fly   354 TDFSLYGNSSSGGGG-----GGSSEKRESSVGGTSKLDKFELDALGYETIEPIGGSHSNITSMFS 413
            .|.|.|..|:|.||.     |..|...:|..||.                :..|.|.|::||..|
  Fly   321 EDSSAYQRSNSVGGNLAGGLGQQSGVSDSDWGGW----------------QDNGNSKSHMTSSSS 369

  Fly   414 RSNDYDKPKTSAPVKKNSGSSQTHTKGGTSTDPVIAQQKFGNSKGFGSDQYFASEQSSADVSASL 478
            ..|.         :..:||       |||:            |.|...|         ||.|.  
  Fly   370 YHNQ---------LSSSSG-------GGTA------------SAGLTRD---------ADWSG-- 395

  Fly   479 NRFQGSRAISSSDYFGDGSPGGTGGNR-------ASSVNFSAPDLDVESVK 522
              |:.:...||...:.:.|.||:...|       :..::.....|||:|||
  Fly   396 --FEATNYQSSETSYQNASSGGSTARRNMKLQDTSQKLSEGFESLDVKSVK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 49/105 (47%)
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720 49/107 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1155557at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.