powered by:
Protein Alignment ArfGAP3 and Agap3
DIOPT Version :9
Sequence 1: | NP_001097664.2 |
Gene: | ArfGAP3 / 40487 |
FlyBaseID: | FBgn0037182 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006236000.1 |
Gene: | Agap3 / 362300 |
RGDID: | 1310751 |
Length: | 1093 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 32/72 - (44%) |
Similarity: | 42/72 - (58%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
:|....|..|.||.|..|.|:|:..|..:||:||.:||:||.||:.|||.:|| :|....|..|.
Rat 850 VRTARGNSFCVDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD-DWPPELLAVMT 913
Fly 85 LGGNANA 91
..|||.|
Rat 914 AMGNALA 920
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5347 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.