DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Agap1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_835220.1 Gene:Agap1 / 347722 MGIID:2653690 Length:857 Species:Mus musculus


Alignment Length:167 Identity:47/167 - (28%)
Similarity:68/167 - (40%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            :|....|..|.||..:.|.|:|:..|..:||:||.:|||||.||:.|||.:|| :|....::.|.
Mouse   615 IRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLD-DWPMELIKVMS 678

  Fly    85 LGGNANAAQFFRAHNCSTTD-------------AQVKYN-------------SRAAQLYRDKLCA 123
            ..||..|...:...:...|.             .:.||.             |...||.|    |
Mouse   679 SIGNELANSVWEEGSQGRTKPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLR----A 739

  Fly   124 QAQQAMKT------HGTKLHLEQTDKSEGNEAAREED 154
            .|::.::|      ||:        :.|.||...|.|
Mouse   740 TAEEDLRTVILLLAHGS--------RDEVNETCGEGD 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 37/126 (29%)
Agap1NP_835220.1 Small GTPase-like 66..276
Centaurin_gamma 72..229 CDD:133303
RAS 73..235 CDD:214541
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 267..342
PH_AGAP 344..592 CDD:241281
PH 347..>411 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..547
ArfGap 611..725 CDD:279720 33/110 (30%)
Ank_2 736..826 CDD:289560 12/45 (27%)
ANK 736..>825 CDD:238125 12/45 (27%)
ANK repeat 768..799 CDD:293786 1/1 (100%)
ANK 1 768..797 1/1 (100%)
ANK 2 801..830
ANK repeat 801..826 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.