DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and RhoGAP15B

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster


Alignment Length:520 Identity:98/520 - (18%)
Similarity:158/520 - (30%) Gaps:191/520 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KYNSRAAQLYRDKLCAQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNV 172
            |.|..|..|:.:  |  |::.:.:.|....:.|.:.|:..:.....|             .|.||
  Fly    44 KLNINAENLHGN--C--AEKKLPSSGQNKLILQENNSDSQQPIYGPD-------------ANENV 91

  Fly   173 SKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSI--GARKVQPKKGGLGARKVGGLGA 235
              |:|...|..|.........|.|..:..:.  ...||..|  .|.::.||              
  Fly    92 --QEPVYATPRPAPRQRLPPAGEPEDSYPDP--DDEVPLRILRAAPQIPPK-------------- 138

  Fly   236 TKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQELSMQKTREEAKLKT 300
               ..|.. ::.|::..:|:.|::    |..|..|:::.|  .|...:...|...::....|.|:
  Fly   139 ---PLNIL-LDQRSSICSEVSTTS----VQTPGKADEDRE--GSRYASNASLDCSESSHSGKFKS 193

  Fly   301 MDP---------------------------AKAKQ-------------MERLGMGFNLRGSDMAH 325
            ..|                           :.|:|             :..||....|.|     
  Fly   194 QSPGYVDAVDSSIPQSDHPDPNGHHPQAESSSAEQSSGSQDGDDDNNLLRSLGTTSKLLG----- 253

  Fly   326 SALGDMETIQQSAAPK-------------------AKLSLLE-SENFFTDFSLYGNSSS-----G 365
            .|:|:..|.:...|.|                   |..||.. |:.|.::|||..|...     |
  Fly   254 EAIGERITFKAKGAKKRLDRNFKSSTEAISNIGADAGRSLKHASKRFGSNFSLGRNKDKADIGIG 318

  Fly   366 GGGGGSSE---KRESSVGGTSKLDKFELDALGYETIEPI---GGSHSNITSMFSRSND------- 417
            |..|||.|   .|..::..|...:..:..:       |:   ||...      .|.||       
  Fly   319 GRPGGSGEMDLDRRQTMPSTEVFNTIQFSS-------PLNRNGGLPD------LRENDAKLQKED 370

  Fly   418 -------------YDKPKTSAPVKKNSGSSQTHTKGGTSTDPVIAQQKFGNSKGFGSDQYFASEQ 469
                         |:.|||..  |..|......::...|..|:                    .:
  Fly   371 YLRPDPDQEDDGCYEVPKTQG--KPPSYDEALRSRPSPSDSPM--------------------SR 413

  Fly   470 SSADVSASLNRFQGSRAISSSDYFGDGSPGGTGGNRASSVNFSAPDLD-------VESVKESVRQ 527
            :.|..:|.|.:.:..|.:|||...||.||      |.....|..|.|.       :::::..|||
  Fly   414 NLAQEAAQLVQLRNQRQLSSSSSNGDESP------RLPMPAFPPPRLSQQPEQFRMDALQPPVRQ 472

  Fly   528  527
              Fly   473  472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 4/12 (33%)
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.