DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and acap3a

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_021325699.1 Gene:acap3a / 322991 ZFINID:ZDB-GENE-030131-1711 Length:845 Species:Danio rerio


Alignment Length:384 Identity:81/384 - (21%)
Similarity:144/384 - (37%) Gaps:97/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASP------AAGPSKQEI---ESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHR 57
            |||      :|..|::..   |::..|:.:.|.|:.|.|||...|.|:|:..|:.:||:||.:||
Zfish   382 ASPSISSIDSASESRERSVRGENILQRILSLPGNQQCCDCAQTEPRWASINLGVLLCIECSGIHR 446

  Fly    58 NLGVHLTFVRSTNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLC 122
            :||||.:.|||..|| :|....|:.|...||:.....:..   |..:..:|..:..:.....:..
Zfish   447 SLGVHCSKVRSLTLD-SWEPELLKLMCELGNSIINHIYEG---SCEEQGLKKPAPNSSRQEKEAW 507

  Fly   123 AQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVIS 187
            .:|:...|....|:...:...:.|.::.|.               .|:...::..:..||.....
Zfish   508 IKAKYVEKKFLKKMMTGEVVVNGGRKSERR---------------WNSRKCRRHNSATTVPKTHR 557

  Fly   188 VETQQGGAPSVNLLNSVVPAAVPSSIGA--RKVQPKK---------------GGLGARKVGGL-- 233
            ...|..|:.|        ||.:.|:..|  ||.:.:.               .|.|.|...||  
Zfish   558 KYRQDPGSAS--------PATLSSATAALERKFRRESLFCPDELDNLFSYFDTGSGPRSPTGLSS 614

  Fly   234 -----GATKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQELSMQKTR 293
                 |:|...|:....|:..::..|.:     ..|.:..:.|.|||..||              
Zfish   615 DSGLGGSTDGSTDVLVFESVVDSVTEEE-----CEVSEDSSNEAELEPEAS-------------- 660

  Fly   294 EEAKLKTMDPAKAKQMERLGMGFN--------LRGSDMAHSALGDMETIQQSAAPKAKL 344
                    ||..:::::...:.:.        :....:||.|  |:.::.:....|:.|
Zfish   661 --------DPEDSRELDAGALLYKACQARNLPVMAEALAHGA--DVNSVNEEDEGKSPL 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 33/103 (32%)
acap3aXP_021325699.1 BAR 16..215 CDD:325158
PH_ACAP 271..367 CDD:270070
ArfGap 403..520 CDD:307528 36/120 (30%)
ANK 674..790 CDD:238125 6/38 (16%)
ANK repeat 674..700 CDD:293786 4/27 (15%)
ANK repeat 702..735 CDD:293786 2/8 (25%)
ANK repeat 737..762 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.