DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Smap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001094139.1 Gene:Smap2 / 298500 RGDID:1308418 Length:428 Species:Rattus norvegicus


Alignment Length:247 Identity:73/247 - (29%)
Similarity:112/247 - (45%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GPSKQEI---ESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRS 68
            |.|.:::   ::|.:.|..:..||.|.||.:|.|.|:|...|:||||.|:.:|||||||::.|:|
  Rat     3 GKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKS 67

  Fly    69 TNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDKLCAQAQQAMKTHG 133
            .||| .||..|::.||..||..|.:.:.|: ...|..:.:.:.......|||...:.........
  Rat    68 VNLD-QWTQEQIQCMQEMGNGKANRLYEAY-LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDI 130

  Fly   134 TKLHLEQTDK-SEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQD------PNPPTVAPVISV--- 188
            ..|..|:.|| ..|:|.|.|:..     ..|.|........|:|      .:|.:.|||:.:   
  Rat   131 NVLRKEKDDKWKRGSEPAPEKKM-----EPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGL 190

  Fly   189 -----------ETQQGGAPSVNLLNSVVPAAVPSSIGARKV--QPKKGGLGA 227
                       :|.......::||.| ||:  |||:..:.|  .|..|..|:
  Rat   191 DAPVACSIANSKTSNALEKDLDLLAS-VPS--PSSVSRKAVGSMPTAGSAGS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 40/103 (39%)
Smap2NP_001094139.1 ArfGap_SMAP2 16..122 CDD:350083 41/107 (38%)
PBP1 <102..419 CDD:227507 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.