DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and APPL1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:521 Identity:97/521 - (18%)
Similarity:173/521 - (33%) Gaps:176/521 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LQLRQM-QLGGNANAAQFFRAHNCS--TTDAQVK-------YNSRAAQ--------------LYR 118
            |.|::: |:..|.:.|...|....|  ..:.:||       |.||..|              .|:
Human   127 LTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYK 191

  Fly   119 DKLC--------AQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEV--------DFNV 167
            .|:.        .|||.:....|::...||.::...|.....::...:.|:::        |..|
Human   192 KKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEV 256

  Fly   168 QNNNVSKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSIGARKVQPKKGG---LGAR- 228
            .::.:...||: ||..||....|::.|     .||:.....:.||...|:....:||   ..|| 
Human   257 ASDPLYVPDPD-PTKFPVNRNLTRKAG-----YLNARNKTGLVSSTWDRQFYFTQGGNLMSQARG 315

  Fly   229 -KVGGLG--ATKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQELSMQ 290
             ..|||.  .........|.|.|.............:.:::.::.:|..|.:.::....:::.:.
Human   316 DVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLS 380

  Fly   291 KTREE-------AKLKTMDPAKAKQMERLGMGFNLRGSDMAHSALGDMETIQQSAAPKAKLSLLE 348
            :..||       :.|:.:.|:.:.|..              |.:|  .....||..|.|:     
Human   381 ENPEETAARVNQSALEAVTPSPSFQQR--------------HESL--RPAAGQSRPPTAR----- 424

  Fly   349 SENFFTDFSLYGNSSSGGGGGGSSEKRESSVGGTSKLDKFELDAL-------GYETIEPIGGSHS 406
                        .||||..|..|           :.|....||:|       .::.|.|:     
Human   425 ------------TSSSGSLGSES-----------TNLAALSLDSLVAPDTPIQFDIISPV----- 461

  Fly   407 NITSMFSRSNDYDKPKTSAPVKKNSGSSQTHTKGGTSTDPVIAQQKFGNSKGFGSDQYFASEQSS 471
                      ..|:|          |.::...:||..|:|      ||.|.|        |.:|.
Human   462 ----------CEDQP----------GQAKAFGQGGRRTNP------FGESGG--------STKSE 492

  Fly   472 ADVS----ASLNRFQGSRAISSSDYFGDGSPGGTGGNRASSVNFSAPDLDVESVKESV-RQGVHK 531
            .:.|    ..:.||.||..:.|.|:                     ||:..|::::.: .:.:|.
Human   493 TEDSILHQLFIVRFLGSMEVKSDDH---------------------PDVVYETMRQILAARAIHN 536

  Fly   532 V 532
            :
Human   537 I 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 14/66 (21%)
APPL1NP_036228.1 Required for RAB5A binding 1..428 62/339 (18%)
BAR_APPL1 20..234 CDD:153315 22/106 (21%)
BAR-PH_APPL 252..376 CDD:270067 27/129 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434 13/69 (19%)
F&H 403..414 3/26 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491 10/37 (27%)
PTB_APPL 490..625 CDD:269980 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.