DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and SPCC622.14

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_588186.2 Gene:SPCC622.14 / 2539181 PomBaseID:SPCC622.14 Length:321 Species:Schizosaccharomyces pombe


Alignment Length:342 Identity:89/342 - (26%)
Similarity:137/342 - (40%) Gaps:77/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQM 83
            :|...|.||.||||.|..|.|:|...|||||:|||..||.|||..:||||..:| ||:..|::.|
pombe     7 QLTRLPENKKCFDCDAPNPQWASCNLGIFICLDCSGQHRGLGVEKSFVRSITMD-NWSERQVKMM 70

  Fly    84 QLGGNANAAQFFRAHNCSTTDAQV--KYNSRAAQLYRDKLCAQAQQAMKTHGTKLHLEQTDKSEG 146
            ::|||:||..|.......:....:  |||:..|:..|.|:.|:..      |.:.......||..
pombe    71 EVGGNSNAKTFLSTDPMFSAAGSIREKYNTDIAEDLRQKIRAEVD------GVEWVKVDRPKSVS 129

  Fly   147 NEAAREEDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPS 211
            :.|                :|.:::      ..||: |.:|.|........:..:||..|..:|.
pombe   130 SHA----------------SVTSSS------TVPTI-PSVSKEANDKYFAKLGSINSQRPDDLPP 171

  Fly   212 SIGAR--------KVQPKKGGLGARKVGGLGATKVKTN-----------FA-DIEARANAANEMK 256
            |.|.|        .|.|..   .||..||....::.:|           |: .:..:....|:..
pombe   172 SQGGRYQGFGSSNSVNPNS---SARNNGGSFLDQLSSNPVSALSHGWNMFSRSVSQQIQDVNKSY 233

  Fly   257 TSAAAAPVVKPQTAEDELETVASMRLAYQELSMQ-----KTREEAKLKTMDPAKAKQMERLGMGF 316
            .......|..|:|.:|.:..:.:.....||.:.|     |:..:..:.:.:|.            
pombe   234 IQPGITKVQDPETRKDYMNAINNFSSNVQEGAKQSFTQLKSFLDENVYSENPQ------------ 286

  Fly   317 NLRGS-----DMAHSAL 328
            |.||:     |..:|||
pombe   287 NTRGTYDAEIDSPYSAL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 45/103 (44%)
SPCC622.14NP_588186.2 COG5347 1..321 CDD:227651 89/342 (26%)
ArfGap 5..115 CDD:279720 47/108 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.