DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Adap1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_766311.2 Gene:Adap1 / 231821 MGIID:2442201 Length:374 Species:Mus musculus


Alignment Length:244 Identity:60/244 - (24%)
Similarity:95/244 - (38%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGPSKQEIESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTN 70
            ||..::.:..:.:|    |.|..|.||.|..|.|:|.|.|:|||:.||.:|||: ..::.|:|..
Mouse     2 AGERRRALLELLTR----PGNTRCADCGAPDPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVR 61

  Fly    71 LDTNWTWLQLRQMQLGGNANAAQFFRA------HNCSTTDAQVKYNS--RAAQLYRDKLCAQAQQ 127
            ||. |...|:..|...||..|...|.:      :..:.:|.|:....  ||....::.:..:.|:
Mouse    62 LDA-WDEAQVEFMASHGNEAARATFESKVPPFYYRPTFSDCQLLREQWIRAKYERQEFVHVEKQE 125

  Fly   128 AMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNVSKQDPNPPTVAPVISVETQQ 192
            ...|...:..|.:..:..|...:|:   |...:.|......|.|.:|:   |..|.         
Mouse   126 PYSTGYREGLLWKRGRDNGQFLSRK---FVLTEREGALKYFNKNDAKE---PKAVM--------- 175

  Fly   193 GGAPSVNLLNSVVPAAVPSSIGARKVQPKKGGLGARKVGGLGATKVKTN 241
                .:..||:.             .||.|.|    ...||..|.:|.|
Mouse   176 ----KIEHLNAT-------------FQPAKMG----HPHGLQVTYLKDN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 35/111 (32%)
Adap1NP_766311.2 ArfGap 10..126 CDD:214518 36/121 (30%)
PH1_ADAP 130..238 CDD:270072 21/110 (19%)
PH2_ADAP 252..357 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.