DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Adap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_742145.1 Gene:Adap2 / 216991 MGIID:2663075 Length:381 Species:Mus musculus


Alignment Length:76 Identity:31/76 - (40%)
Similarity:37/76 - (48%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLG 86
            |...|..|.||.|..|.|:|...|||||:.||.||||. ..::.|:|..||. |....:..|...
Mouse    18 AGTGNGHCADCGAADPDWASYKLGIFICLHCSGVHRNF-PDISKVKSVRLDF-WDDSMVEFMTHH 80

  Fly    87 GNANAAQFFRA 97
            ||.|....|.|
Mouse    81 GNLNVKAKFEA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 31/76 (41%)
Adap2NP_742145.1 ArfGap 9..123 CDD:279720 31/76 (41%)
PH1_ADAP 133..241 CDD:270072
PH 135..231 CDD:278594
PH2_ADAP 255..362 CDD:241282
PH 258..361 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.