DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Adap2

DIOPT Version :10

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_742145.1 Gene:Adap2 / 216991 MGIID:2663075 Length:381 Species:Mus musculus


Alignment Length:76 Identity:31/76 - (40%)
Similarity:37/76 - (48%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLG 86
            |...|..|.||.|..|.|:|...|||||:.||.||||. ..::.|:|..||. |....:..|...
Mouse    18 AGTGNGHCADCGAADPDWASYKLGIFICLHCSGVHRNF-PDISKVKSVRLDF-WDDSMVEFMTHH 80

  Fly    87 GNANAAQFFRA 97
            ||.|....|.|
Mouse    81 GNLNVKAKFEA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap_ArfGap2_3_like 12..127 CDD:350060 31/76 (41%)
Adap2NP_742145.1 ArfGap_ADAP2 4..117 CDD:350070 31/76 (41%)
PH1_ADAP 133..241 CDD:270072
PH2_ADAP 255..362 CDD:241282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.