DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Agap3

DIOPT Version :10

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_006535736.1 Gene:Agap3 / 213990 MGIID:2183446 Length:1093 Species:Mus musculus


Alignment Length:72 Identity:32/72 - (44%)
Similarity:42/72 - (58%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            :|....|..|.||.|..|.|:|:..|..:||:||.:||:||.||:.|||.:|| :|....|..|.
Mouse   850 VRTVRGNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD-DWPPELLAVMT 913

  Fly    85 LGGNANA 91
            ..|||.|
Mouse   914 AMGNALA 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap_ArfGap2_3_like 12..127 CDD:350060 32/72 (44%)
Agap3XP_006535736.1 Centaurin_gamma 310..467 CDD:133303
PH_AGAP 583..827 CDD:241281
PRK07003 <645..>756 CDD:235906
ArfGap_AGAP3 843..952 CDD:350080 32/72 (44%)
ANKYR <971..>1060 CDD:440430
ANK repeat 971..1001 CDD:293786
ANK repeat 1003..1034 CDD:293786
ANK repeat 1036..1061 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.