DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Agap3

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_006535736.1 Gene:Agap3 / 213990 MGIID:2183446 Length:1093 Species:Mus musculus


Alignment Length:72 Identity:32/72 - (44%)
Similarity:42/72 - (58%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            :|....|..|.||.|..|.|:|:..|..:||:||.:||:||.||:.|||.:|| :|....|..|.
Mouse   850 VRTVRGNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD-DWPPELLAVMT 913

  Fly    85 LGGNANA 91
            ..|||.|
Mouse   914 AMGNALA 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 32/72 (44%)
Agap3XP_006535736.1 Centaurin_gamma 310..467 CDD:133303
PH_AGAP 583..827 CDD:241281
PRK07003 <645..>756 CDD:235906
ArfGap_AGAP3 843..952 CDD:350080 32/72 (44%)
Ank_2 971..1061 CDD:372319
ANK repeat 971..1001 CDD:293786
ANK repeat 1003..1034 CDD:293786
ANK repeat 1036..1061 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.