DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and Asap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_006515110.1 Gene:Asap2 / 211914 MGIID:2685438 Length:1003 Species:Mus musculus


Alignment Length:514 Identity:113/514 - (21%)
Similarity:187/514 - (36%) Gaps:127/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QEI-ESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTN 74
            ||: :.:.|.::....|..|.||.|..|||.|...||..||:||.:||.||||.:.::|..||. 
Mouse   420 QELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV- 483

  Fly    75 WTWLQLRQMQLGGNANAAQFFRAHNCS-TTDAQVKYNSRAAQLYR-DKLCA---QAQQAMKTH-- 132
               |...::.|..|...|.|.....|. .::..||.|..:..:.| |.:.|   :.:.|.|.|  
Mouse   484 ---LGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYARKKHAD 545

  Fly   133 -GTKLH---------------------LEQTDK---SEGNE--------AAREEDFFAQCDNEVD 164
             ..|||                     ::.|:|   :.|:|        |.|..|..:.  :.||
Mouse   546 TAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTSL--HIVD 608

  Fly   165 FNVQNN-NVSKQDPNPPTV---------APVISVETQQGGAPSVNLLNSVVPAAVPSSIGARKVQ 219
            |.|||: |:.||.....|.         |..:.:..:  |..|:.:.|.  ....|..|..|...
Mouse   609 FLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLR--GKASIEIANE--SGETPLDIAKRLKH 669

  Fly   220 PKKGGLGARKVGGLGATKVKTNF------ADIEARANAANEMKTSAAAAPVVKPQTAEDELETVA 278
            .....|..:.:.|...:.|...:      .|::...:..:|....:       |...||.     
Mouse   670 EHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPS-------PNRREDR----- 722

  Fly   279 SMRLAYQELSMQKTREEAKLKTMDPAKAKQMERLGMGFNLRGSDMAHSALGDMETIQQSAAPK-- 341
              .:::.:|...:.:..|.....|.|...:.::.|.|.::..::...:.|.......||..|.  
Mouse   723 --PVSFYQLGSSQFQSNAVSLARDTANLTKDKQRGFGPSILQNETYGAILSGSPPSSQSIPPSTT 785

  Fly   342 ----------AKLSLLESENFFTDFSLYGNSSSGGGGGGSSEKRESSVGGTSKLDKFELDALGYE 396
                      .|:....|.|     :|:..:|.  |..|.|.:|.||          :|.|: :.
Mouse   786 SAPPLPPRNVGKVQTATSAN-----TLWKTNSV--GVDGISRQRSSS----------DLPAV-HP 832

  Fly   397 TIEPIGGSHSNITSMFSRSNDYDKPKTSA---PVKKNSGSSQTHTKGGTSTDPVIAQQK 452
            .:.|:..:.:|             |.|:.   ||.|.||:.:...:...|:.|..:|.|
Mouse   833 PLPPLRVTSTN-------------PLTTTPPPPVAKTSGTLEAMNQPSKSSQPGTSQSK 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 36/105 (34%)
Asap2XP_006515110.1 BAR_ASAP2 34..248 CDD:153326
PH_ASAP 300..406 CDD:270071
ArfGap_ASAP2 422..544 CDD:350074 39/125 (31%)
ANK repeat 553..585 CDD:293786 2/31 (6%)
ANK repeat 589..621 CDD:293786 11/33 (33%)
Ank_2 592..676 CDD:372319 20/89 (22%)
ANK repeat 623..654 CDD:293786 4/32 (13%)
SH3_ASAP2 945..1000 CDD:212899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.