DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and terfa

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_009299378.1 Gene:terfa / 192316 ZFINID:ZDB-GENE-020419-38 Length:610 Species:Danio rerio


Alignment Length:402 Identity:83/402 - (20%)
Similarity:125/402 - (31%) Gaps:119/402 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSKQEIESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTF-VRSTNL 71
            |||          |..|.:.:..|..|:             |:  |||.|. |:...| :.|...
Zfish   225 PSK----------RTPPHSSAAEDHGAE-------------CV--SAVSRQ-GLQQVFDLLSEQY 263

  Fly    72 DTNWTWLQL--------RQMQLGGNANAAQFFRAHNCSTTDAQVKYNS---------RAAQLYRD 119
            ....::.||        :|.|.||.|......   ..|.|..|....|         |.|.:...
Zfish   264 GVGISFFQLQDSVEVEAQQQQEGGVAGPELCL---TLSETPMQTVILSDTEEQDEPRRYAGMTIS 325

  Fly   120 KLCAQAQQAMKTHGTKLHLEQTDKSEGNEAAREEDF-FAQCDNEVD------------------F 165
            :|..:....:....|  |:|..::.|.....|..|: ....|.|.|                  .
Zfish   326 RLVQEEDSQISAEHT--HIEDDEEEEQTHTHRGGDWVVVLSDLESDDLDVQAGPVSSPSLRHTPK 388

  Fly   166 NVQNNNVSKQDP--------NPPTVAPVISVETQQGGAPSVNLLNSVVPAAVPSSIGARKVQPKK 222
            |.||.:.|..:|        .|..:....:...||..:.|   .:|....:.|    ||...|..
Zfish   389 NRQNQHSSLSEPQCSSTQRSTPARLCKRSNTRVQQSESES---QSSPAHCSTP----ARPSHPSN 446

  Fly   223 GGLGARKVGGLGATKVKTNFADIEARANAANEMKTSAAAAPVVKPQTAEDELETVASMRLAYQEL 287
            .....||       |..:....||: :::.||..|.|||....:.|..:.....|:|    ..|.
Zfish   447 PRSSTRK-------KTPSRRRIIES-SDSENEQTTPAAATHTPRGQRQQHRSIRVSS----GSEP 499

  Fly   288 SMQKTREEAKLKTMDPA--------KAKQMERLGMGFNLRGSD-MAHSALGDMETIQQSAAPKAK 343
            .:..|...|..:...|.        ::|.::..|:..|....| :.|:          |.||..|
Zfish   500 EVDSTSPAAHTRRSTPTSTHTRTTKRSKWLDASGIQDNWSDEDSLFHT----------STAPAKK 554

  Fly   344 L-----SLLESE 350
            .     |:.|||
Zfish   555 YTRKMWSVQESE 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 25/121 (21%)
terfaXP_009299378.1 TRFH 7..203 CDD:238174
SANT_TRF 558..606 CDD:212558 4/9 (44%)
SANT 560..606 CDD:197842 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.