DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and git-1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_509761.2 Gene:git-1 / 181253 WormBaseID:WBGene00008805 Length:670 Species:Caenorhabditis elegans


Alignment Length:226 Identity:48/226 - (21%)
Similarity:78/226 - (34%) Gaps:67/226 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQLGGNANA 91
            |.|.||..|...|:||..|..||.:|...|..||..::::|... .:.|....:|.:        
 Worm    16 KECDDCGKKEVEWASVKKGTVICSECFCFHSYLGPSVSYLRHLR-KSAWDEEHIRLV-------- 71

  Fly    92 AQFFRAHNCSTTDAQVKYNSRAAQLYR-----DKLCAQ-----AQQAMKTHGTKLHLEQTDKSEG 146
                  |..:|::..:.:.|   .||.     .|..||     .:|.:|....||..:.      
 Worm    72 ------HALNTSNTNMIWES---ALYEGSTKFQKPMAQDPSHIKEQFVKEKYEKLTFQP------ 121

  Fly   147 NEAAREEDFFAQCDNEVDFNVQNNNVSKQD-----------------PNPPTVAPVISVETQQGG 194
             :..::||.      |...|.|....::.|                 |:|.|....:.|..::|.
 Worm   122 -KRGKDEDL------ENSLNRQLIACARSDFAHVTLRLIALGADVNYPDPETGDTALHVAAREGN 179

  Fly   195 APSVNLLNSVVPAAVPSSIGARKVQPKKGGL 225
            :..|.||         ...||..:.|.:.|:
 Worm   180 SNQVELL---------FLYGADIMAPNREGM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 23/98 (23%)
git-1NP_509761.2 ArfGap 7..127 CDD:214518 30/135 (22%)
ANK <122..212 CDD:238125 18/95 (19%)
Ank_5 152..207 CDD:290568 12/59 (20%)
ANK repeat 165..197 CDD:293786 8/40 (20%)
GIT 264..294 CDD:128828
GIT 326..356 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.