DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and cnt-2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001022836.1 Gene:cnt-2 / 176490 WormBaseID:WBGene00000566 Length:1107 Species:Caenorhabditis elegans


Alignment Length:76 Identity:33/76 - (43%)
Similarity:43/76 - (56%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            ||:.|.|..|.||...:..|:|:..||.|||:||.:|||||.|::.||...|| .|....|..||
 Worm   828 LRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELD-QWPVEHLAVMQ 891

  Fly    85 LGGNANAAQFF 95
            ..||..|.:.:
 Worm   892 AIGNDKANEMW 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 33/76 (43%)
cnt-2NP_001022836.1 Centaurin_gamma 235..393 CDD:133303
PH_AGAP 608..806 CDD:241281
ArfGap 825..938 CDD:307528 33/76 (43%)
ANK <949..1034 CDD:238125
ANK repeat 949..978 CDD:293786
ANK repeat 980..1011 CDD:293786
ANK repeat 1013..1041 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.