DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and F07F6.8

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001379858.1 Gene:F07F6.8 / 173926 WormBaseID:WBGene00017220 Length:318 Species:Caenorhabditis elegans


Alignment Length:182 Identity:35/182 - (19%)
Similarity:57/182 - (31%) Gaps:73/182 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VPAAVPSSIGARKVQPKKGGLGARKVGGLGATKVKTNFADIEARANAANEMKTSAAAAPVVKPQT 269
            :..||.|::|...        |...:|||...........|...|:..:.:.|........|.|.
 Worm    80 ISTAVGSTVGIAS--------GIAVIGGLILMPPVAIAGLIVGTASGVSNLATGITKFFHTKGQH 136

  Fly   270 AEDELETVASM----RLAYQELSMQKTREEAKLKTMDPAKAKQMERLGMGFNLRGSDMAHSALGD 330
            .|     ||:|    .:.::||  .|:|||.                                  
 Worm   137 KE-----VAAMIAEDGVLFEEL--LKSREEL---------------------------------- 160

  Fly   331 METIQQSAAPKAKLSLLESENFFTDF-----------SLYGNSSSGGGGGGS 371
            ||.:::         ::|.|.||..|           :::|.|.:|..|.|:
 Worm   161 MEAVRK---------IVEDEEFFKHFKNDGDIENKLKTVFGGSVTGITGIGT 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518
F07F6.8NP_001379858.1 ApoL <59..>126 CDD:398882 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.