DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and AGAP1

DIOPT Version :10

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001423054.1 Gene:AGAP1 / 116987 HGNCID:16922 Length:1122 Species:Homo sapiens


Alignment Length:163 Identity:46/163 - (28%)
Similarity:67/163 - (41%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNWTWLQLRQMQ 84
            :|....|..|.||..:.|.|:|:..|..:||:||.:|||||.||:.|||.:|| :|....::.|.
Human   880 IRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLD-DWPVELIKVMS 943

  Fly    85 LGGNANAAQFFRAHNCSTTDAQV-------------KYNSR---------AAQLYRDKLCAQAQQ 127
            ..||..|...:...:...|...|             ||..:         ...|.:..|.|.|.:
Human   944 SIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADE 1008

  Fly   128 AMKT------HGTKLHLEQTDKSEGNEAAREED 154
            .::|      ||:        :.|.||...|.|
Human  1009 DLRTAILLLAHGS--------RDEVNETCGEGD 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap_ArfGap2_3_like 12..127 CDD:350060 38/128 (30%)
AGAP1NP_001423054.1 Centaurin_gamma 337..494 CDD:133303
PH_AGAP 609..857 CDD:241281
ArfGap_AGAP2 874..982 CDD:350078 33/102 (32%)
ANKYR <1001..>1090 CDD:440430 11/41 (27%)
ANK repeat 1033..1064 CDD:293786 1/1 (100%)
ANK repeat 1066..1091 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.