powered by:
Protein Alignment ArfGAP3 and AGAP2
DIOPT Version :9
Sequence 1: | NP_001097664.2 |
Gene: | ArfGAP3 / 40487 |
FlyBaseID: | FBgn0037182 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001116244.1 |
Gene: | AGAP2 / 116986 |
HGNCID: | 16921 |
Length: | 1192 |
Species: | Homo sapiens |
Alignment Length: | 56 |
Identity: | 29/56 - (51%) |
Similarity: | 37/56 - (66%) |
Gaps: | 1/56 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTNW 75
:|....|..|.||.|..|||:|:..|..|||:||.:|||||.||:.|||.:|| :|
Human 937 IRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLD-DW 991
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5347 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.