DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and ARAP1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001035207.1 Gene:ARAP1 / 116985 HGNCID:16925 Length:1450 Species:Homo sapiens


Alignment Length:565 Identity:119/565 - (21%)
Similarity:190/565 - (33%) Gaps:166/565 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTN-WT--- 76
            |..|:.|...|:.|.||.|..|.|:|:...:.||..|:..||.||..::.|||..:|.. ||   
Human   537 VAERIWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETL 601

  Fly    77 ---WLQLRQMQLGGNANAAQFFRAHNCSTTDA--------------QVKYNSRAAQLYR------ 118
               :|||      ||....:|:.| |...::|              :.||.....:.|.      
Human   602 IELFLQL------GNGAGNRFWAA-NVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQ 659

  Fly   119 ---DK-LCAQA-------QQAMKTHGTKLHLEQTDKSEGNEAAREEDFFAQCDNEVDFNVQNNNV 172
               || |||..       .||:...|..::....|.......|..|........|...|.:...|
Human   660 EELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNRTTEV 724

  Fly   173 SKQDPNPP------TVAPVIS-----VETQQGGAPSVNLLNS------------VVPAAVPSSIG 214
            .:.|...|      .|.|.:|     .:|...|    .||..            |:...|.|...
Human   725 PRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAG----KLLQDRRAREEFSRRWCVLGDGVLSYFE 785

  Fly   215 ARKVQPKKGGLGARKVGGLGATKVKTN--------FADIE-------ARANAANEMKTSAAAAPV 264
            ..:.....|.:.|.::..|......|:        :.:.|       ..|..|:|.....|.|.|
Human   786 NERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHEWVKCIAKAFV 850

  Fly   265 VKPQTAED----ELETVASMRLAYQE-LSMQKTRE------EAKLKTM-------DPAKAKQMER 311
              |..|||    :.|.:.  ||.|:. ||:|:.:|      .::|:.:       :|.:.::::.
Human   851 --PPLAEDLLARDFERLG--RLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQE 911

  Fly   312 LGMGFNLRGSDMAHSALGDMETIQQSAAPKAKLSLLESENFFTDFSLYGNSSSGGGGGGSSEKRE 376
            |             |..||.|........:.:...::.|... ||.         |..|:.:|..
Human   912 L-------------SIQGDSENQVLVLVERRRTLYIQGERRL-DFM---------GWLGAIQKAA 953

  Fly   377 SSVGGT---SKLDKFELDALGYETIEPIGGSHSNITS--MFSRSNDYDKPKTSAPVKKNSGSSQT 436
            :|:|.|   .:|...::..:.|..::.|  :...:||  ::.:.....|.:......:....| .
Human   954 ASMGDTLSEQQLGDSDIPVIVYRCVDYI--TQCGLTSEGIYRKCGQTSKTQRLLESLRQDARS-V 1015

  Fly   437 HTKGGTSTDPVIAQQKFGNSKGFGSDQYFASEQSSADVSASLNRF 481
            |.|.|                          ||...|||::|.||
Human  1016 HLKEG--------------------------EQHVDDVSSALKRF 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 37/134 (28%)
ARAP1NP_001035207.1 SAM_Arap1,2,3 6..68 CDD:188889
SAM 10..64 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..144
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..302
PH 328..419 CDD:278594
PH1_ARAP 329..421 CDD:270073
PH2_ARAP 436..525 CDD:270074
ArfGap 535..651 CDD:279720 35/120 (29%)
PH3_ARAP 743..849 CDD:270076 17/109 (16%)
PH 744..848 CDD:278594 17/107 (16%)
PH4_ARAP 862..952 CDD:270077 20/114 (18%)
RhoGAP_ARAP 956..1135 CDD:239850 20/108 (19%)
RA 1172..1261 CDD:279168
PH5_ARAP 1263..1402 CDD:270079
PH 1299..1391 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.