DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and adap2

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_021329475.1 Gene:adap2 / 100331455 ZFINID:ZDB-GENE-070912-21 Length:418 Species:Danio rerio


Alignment Length:175 Identity:43/175 - (24%)
Similarity:70/175 - (40%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKQEIESVFSRLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDT 73
            ::::.:.:...|...|.|..|.||.|..|.|:|...|||:|:.||..||||.. ::.::|..||.
Zfish     3 NREKNKKILLELVKLPENNCCADCGAADPDWASCKLGIFVCLTCSGTHRNLPT-ISRIKSIRLDF 66

  Fly    74 NWTWLQLRQMQLGGNANAAQFF-----------RAHNCSTTDAQ---VKYNSR-----------A 113
             |....::.|:..||.:|..|:           ..|:|.....|   .||...           .
Zfish    67 -WDDELVQFMKANGNCSAKNFYEKCVPVFYYRPHPHDCEVLREQWIRAKYERMEFTEEKTERPYT 130

  Fly   114 AQLYRDKLCAQAQQ---------AMKTHGTKLHLEQTDKSEGNEA 149
            |.:|...|..:.:.         .:..|...|...:.|:|:|.:|
Zfish   131 ADVYEGMLWKKGRDNGQFLERKFVLSVHDFTLKYYKEDESKGPKA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 36/128 (28%)
adap2XP_021329475.1 ArfGap 8..123 CDD:307528 34/116 (29%)
PH1_ADAP 134..240 CDD:270072 8/42 (19%)
PH2_ADAP 254..361 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.