DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and agap1

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_009300560.1 Gene:agap1 / 100148154 ZFINID:ZDB-GENE-130405-1 Length:1255 Species:Danio rerio


Alignment Length:165 Identity:54/165 - (32%)
Similarity:78/165 - (47%) Gaps:36/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SKQEIESVFSRLRAQP------------ANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGV 61
            |||:     |||.:|.            .|..|.||.|:.|.|:|:..|..|||:||.:|||||.
Zfish   994 SKQK-----SRLSSQSEAIALQSVRNMRGNTRCVDCEAQNPDWASLNLGALICIECSGIHRNLGT 1053

  Fly    62 HLTFVRSTNLDTNWTWLQLRQMQLGGNANAAQFFRAHNCSTTDAQVKYNSRAAQLYRDK-LCAQA 125
            ||:.|||.:|| .|....::.|...||..|...:.|:    ...::|....|::..|:: :.|:.
Zfish  1054 HLSRVRSLDLD-EWPLELIKVMSAIGNELANSVWEAN----AQGRLKPAPDASREERERWIRAKY 1113

  Fly   126 QQAMKTHGTKLHLEQ---TDKSEGNE---AAREED 154
            :|       ||.|..   |:.|.|.:   |..|||
Zfish  1114 EQ-------KLFLASLTCTELSLGQQLLRATAEED 1141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 39/116 (34%)
agap1XP_009300560.1 Centaurin_gamma 439..601 CDD:133303
RAS 440..607 CDD:214541
PH_AGAP 716..989 CDD:241281
PH 719..>783 CDD:278594
PH <933..984 CDD:278594
ArfGap 1008..1118 CDD:279720 38/121 (31%)
Ank_2 1133..1223 CDD:289560 4/9 (44%)
ANK 1133..>1222 CDD:238125 4/9 (44%)
ANK repeat 1165..1196 CDD:293786
ANK repeat 1198..1223 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.