DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ArfGAP3 and LOC100005008

DIOPT Version :9

Sequence 1:NP_001097664.2 Gene:ArfGAP3 / 40487 FlyBaseID:FBgn0037182 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_001344168.4 Gene:LOC100005008 / 100005008 -ID:- Length:958 Species:Danio rerio


Alignment Length:191 Identity:51/191 - (26%)
Similarity:73/191 - (38%) Gaps:49/191 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLRAQPANKSCFDCAAKAPTWSSVTYGIFICIDCSAVHRNLGVHLTFVRSTNLDTN-WTWLQLRQ 82
            ||.:.|.||.|.||.|..|.|:||...:.||..|:..||::|...:.||...||.. ||...::.
Zfish   391 RLWSSPCNKVCADCGAANPEWASVNLLVVICEACAGAHRSMGSSRSKVRGLKLDDKVWTEPLIQL 455

  Fly    83 MQLGGNANAAQFFRAHNCSTTDAQV---------------KYNS---RAA-----------QLYR 118
            ..|.||..|...: .||...|: |:               ||:.   |.|           |..|
Zfish   456 FVLHGNKTANNVW-GHNIPPTE-QISPLASPDQRAEFILAKYHKGLYRKAHPLAASQKLLDQRLR 518

  Fly   119 DKLCAQAQQ---AMKTHGTKLHLEQTD----------KSEG----NEAAREEDFFAQCDNE 162
            :.:|..|.:   ::...|.|:....:|          :|.|    .|..|..:|....|.|
Zfish   519 EVVCGPAVEETVSLLCSGAKVSCSSSDPELKSAIAVAESAGQALQTELLRHNEFVEAPDFE 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArfGAP3NP_001097664.2 ArfGap 17..121 CDD:214518 39/131 (30%)
LOC100005008XP_001344168.4 PH-like 291..375 CDD:302622
PH 292..380 CDD:278594
ArfGap 386..503 CDD:279720 36/113 (32%)
RhoGAP 769..939 CDD:295372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.