DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG13590

DIOPT Version :9

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:143 Identity:26/143 - (18%)
Similarity:53/143 - (37%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YDNSDPHLNFSMEVHQELHDVDIHVE-VRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVH 110
            |..:...||.::...:...::.:|.: ::..|...|:.   .:.|.:.|..:...|: ||.:.:.
  Fly    50 YSRAKTSLNINVTFVEPARNISVHFKTMKKANGYKPFL---FDYTFDACEFMRRRNQ-PVAKIIW 110

  Fly   111 GFIREFGNIVETCPIAKGRYH-------WHRIHLKRKLQGSYFINKFWWPEDPTTAMLPELEFEI 168
            ..||....|..|||     |.       :|::.:...|....::....|..|..|.....:.|..
  Fly   111 YMIRNVSTINHTCP-----YEGLQMLSDFHKVDIPVPLPSGDYLLMVDWLFDGKTQFATNVYFTF 170

  Fly   169 IWQAMHVDASKKR 181
            |...:...:..:|
  Fly   171 IEDLLPTSSKHRR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 20/107 (19%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.