DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33795

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:109 Identity:26/109 - (23%)
Similarity:44/109 - (40%) Gaps:22/109 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NFSMEVHQELHDVDIHVEVRITNKQDPY----YNTNLNTTLNVCRILGFANKSP---VGRFVHGF 112
            ||:..:|...:||.|  :.|...:::.|    |..|::.    ||.|    :.|   :.:.::..
  Fly    59 NFNATIHHPTNDVVI--DYRFLKRENGYKPWLYKKNIDG----CRFL----RKPYDMLTKMIYMV 113

  Fly   113 IREFGNIVETCP-----IAKGRYHWHRIHLKRKLQGSYFINKFW 151
            .:.|.||..|||     :.:|.|....|.......|.|.:...|
  Fly   114 FKPFSNINHTCPFYGDILIRGMYLRTEIKAMPYPSGKYMLQINW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 19/82 (23%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 18/83 (22%)

Return to query results.
Submit another query.