DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33648

DIOPT Version :9

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:119 Identity:25/119 - (21%)
Similarity:44/119 - (36%) Gaps:19/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNI-VETCPIAKGRYHWHR 134
            :.|.:..:.:.|.....|.:::.||.|.....:.|.:::...|....|| ..|||       ::.
  Fly    71 INVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCP-------FNS 128

  Fly   135 IHLKRKLQGSYFINKFWWPEDPTTAMLPELE----FEIIWQAMHVDASKKRTLI 184
            .....||..::..||.       |.:||..|    |...|.:.::..|.....|
  Fly   129 FISVDKLTTNFLNNKL-------TQVLPVPEGDYLFAFRWFSYNIYRSSVNVYI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/108 (22%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.