DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33783

DIOPT Version :9

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:100 Identity:23/100 - (23%)
Similarity:39/100 - (39%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VHQELHDVDIHVEV------RITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGN 118
            :|.:.|.:.|:...      |..|...|:.   .|.|:::|.......:.|....|:..|:.|.|
  Fly    42 LHAQAHQLPINSSTCILSLYRRFNGYRPFL---YNMTVDICSFFKNRKRYPFVDLVYDAIKNFSN 103

  Fly   119 IVETCPIAKGRYHWHRIHLKRKLQGSYFINKFWWP 153
            :..:||      |.|.|.:.|.:.....|.|..:|
  Fly   104 VNHSCP------HNHDIIVNRMVLNDNMIVKVPFP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 16/71 (23%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.