DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33796

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:134 Identity:31/134 - (23%)
Similarity:48/134 - (35%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 HKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNL-NTTLNVCRILGFANKSP-- 104
            |:.|:       ||:.........:.:|.:   |.|::..|...| ||.::.||.|    :.|  
  Fly    55 HRTVF-------NFNATFLYPTKSITVHYQ---TFKRENGYRPWLVNTQIDGCRFL----RKPYD 105

  Fly   105 -VGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKFWWPEDPTTAMLPELEF-- 166
             :|..:....|.|.||..|||                |||...:...:...|.....||..::  
  Fly   106 ALGILLFNIYRNFTNINHTCP----------------LQGDMIVRNMYLTTDVMRLPLPTGDYLL 154

  Fly   167 EIIW 170
            .|.|
  Fly   155 AIDW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 24/95 (25%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 25/102 (25%)

Return to query results.
Submit another query.