DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33752

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:143 Identity:25/143 - (17%)
Similarity:52/143 - (36%) Gaps:44/143 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYH-- 131
            |.|...:..|...|:....|.|::.|..:...|...:..:.:..::.:.|...:||     |:  
  Fly    70 ISVNFTVYKKLSGYHPFLFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCP-----YNVS 129

  Fly   132 --WHRIHLKRKLQGSYFINKFWWPEDPTTAMLP--------ELEFEIIWQAMHVDASKKRTLIMN 186
              :|.|.:|     .:.:....:.:.|    ||        :|..:.:|:           :::|
  Fly   130 ESYHDILVK-----DFVLTDTMFAKIP----LPTGNYMFSIKLATDDVWR-----------VVLN 174

  Fly   187 DHFGGDFVVQDVN 199
            .:|       |||
  Fly   175 TYF-------DVN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 18/118 (15%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 17/100 (17%)

Return to query results.
Submit another query.