DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33927

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:45/106 - (42%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LNFSMEVHQELHDVDIHVEV-RITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFG 117
            |:|:..|.:.:....:|.:: :..|...|:.   .|.|.:.||.|....::|| ..|...::.|.
  Fly    60 LSFNGTVLKTISKFRVHGQIFKRANGFKPWL---YNITFDGCRFLRKPYEAPV-IIVFNLLKSFS 120

  Fly   118 NIVETCPIAKGRYHWHRIHLKRKL------QGSYFINKFWW 152
            |:..|||. .|..|...:|:..:.      .|.|.|...|:
  Fly   121 NLNFTCPY-MGPVHIMGLHIIGEQIPVPLPTGEYLIQIKWY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 20/77 (26%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 21/84 (25%)

Return to query results.
Submit another query.