DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG13193

DIOPT Version :9

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:159 Identity:28/159 - (17%)
Similarity:58/159 - (36%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MRPKFKDIKFWSDEKFVSHKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQ----DPYYNT 85
            :|.||.:|.....:.:.|....:..:...||..:.:::.|.:   .:...||..|    ...|.|
  Fly    33 LRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKN---GLRTTITLLQLIDGKDRYQT 94

  Fly    86 NLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKF 150
            ..:..::.|:.|....:|.:.:.....:.::||:.:.|||....|......|:......|....|
  Fly    95 LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPAGF 159

  Fly   151 WWPED-------------PTTAMLPELEF 166
            :...|             |....:.:::|
  Fly   160 YRLHDTNYYGKPKGRQRRPVATFILDIKF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 17/98 (17%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 16/91 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.