DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14456 and CG33483

DIOPT Version :10

Sequence 1:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:102 Identity:23/102 - (22%)
Similarity:46/102 - (45%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFKDIKFWS-DEKF----VSHKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQDPYYNTNL 87
            :|.:||..| |:.|    ..|....:.|..:|:..:.:| ::....:.|...:..:.:.|.....
  Fly    76 EFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLH-KVPITKVKVNFSLLKRFNGYKPFLY 139

  Fly    88 NTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP 124
            |.|::.|:.|..:..:|:..|.:|..:...|:..|||
  Fly   140 NITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14456NP_001137998.1 DM8 82..189 CDD:214778 12/43 (28%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 13/54 (24%)

Return to query results.
Submit another query.