DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG34260

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:59/153 - (38%) Gaps:39/153 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FLDLKVDLQNDSGESNLSIDIKT--------------------------------HQDIEDVQLV 76
            ||.|::.|    .::|..|.|||                                :|.||...::
  Fly    11 FLPLQLGL----AKNNYDIAIKTLGCQIIAKAYVNSLECLLVRQRTAVVAVKFSLNQTIEHFDVL 71

  Fly    77 VDFGL-ETDKGNYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSG-TYSLTN 139
            ..|.| :.||...: :.:..::.||.:.....:.:|..:::.|.....|...||:..| .|.:.|
  Fly    72 ATFDLIKKDKSRMN-IADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRN 135

  Fly   140 YNVDEEMLPSFLPEAKFRFGMKI 162
            |....:..|...|:||::..:|:
  Fly   136 YTFISDEFPPGAPQAKWQVRLKL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/77 (21%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007613
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.