DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG14456

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:195 Identity:47/195 - (24%)
Similarity:91/195 - (46%) Gaps:23/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQDIEDVQLVVDF 79
            :|:|:...:.|.:..:.....|.|.:::||:..||...|.....|.|:::  ||::.||.:.|:.
  Fly    11 VLMAMCHGSLAEKMMRPKFKDIKFWSDEKFVSHKVVYDNSDPHLNFSMEV--HQELHDVDIHVEV 73

  Fly    80 GLETDKGN--YSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIR----------- 131
            .: |:|.:  |:|.:|.|||.|:::...|..|:.|.::..:.:.|.:.:.|||.           
  Fly    74 RI-TNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRIHL 137

  Fly   132 ----SGTYSLTNYNVDEEMLPSFLPEAKFRF---GMKISTDKGGMIVRSTIFGRIDKSKGFDNLK 189
                .|:|.:..:...|:...:.|||.:|..   .|.:...|...::.:..||.....:..:|||
  Fly   138 KRKLQGSYFINKFWWPEDPTTAMLPELEFEIIWQAMHVDASKKRTLIMNDHFGGDFVVQDVNNLK 202

  Fly   190  189
              Fly   203  202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 25/111 (23%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.