DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG13250

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:78 Identity:16/78 - (20%)
Similarity:41/78 - (52%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSG-TYSLTNYNVDEEMLPSFLPEAKFRFGMKI 162
            |.|::.|:...::.|:...||:.|.....||:.:. .|:.|.:.::.:..|:::|:.||...:..
  Fly   107 CHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALNPDHFPAYMPDMKFNTKLVF 171

  Fly   163 STDKGGMIVRSTI 175
            ...:...::|:::
  Fly   172 QLSRNMGLIRASV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/78 (21%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.