DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33632

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:177 Identity:43/177 - (24%)
Similarity:68/177 - (38%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IRSCCAVAFILVALMPLTGAWRSFKVILTSIDFEAND------------------KFLDLKVDLQ 52
            ::.|  |||.|:.:..||..:.  .|..|::..|..|                  |::.|||.| 
  Fly     5 LKLC--VAFQLICIYYLTEVYS--LVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKL- 64

  Fly    53 NDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYST-LINRTLNFCKLMKQRNSDPLVRAIYE 116
                   |.|.:        .::.|.|||......|.. |.|.||:.|:.:|.||.:|:....|.
  Fly    65 -------LKIPV--------TKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYN 114

  Fly   117 DLLKHGTLFKECP------IRSGTYSLTNYNVDEEMLPSFLPEAKFR 157
            ....:..:...||      :...:|...||.: .|:||  .||..::
  Fly   115 LFKDYSNINHTCPYNHDLVLDEMSYHSINYKL-TEILP--FPEGNYK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 21/78 (27%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 22/84 (26%)

Return to query results.
Submit another query.