DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG12849

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:172 Identity:30/172 - (17%)
Similarity:62/172 - (36%) Gaps:58/172 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FILVALMPLT--GAWRSFKVIL-----TSIDFE--------ANDKFLDLKVD---LQNDSGESNL 60
            |:|:.:.|:.  |.:....|:.     ..:|||        ...|:|.||..   |..|:.|:..
  Fly     7 FLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRF 71

  Fly    61 SIDIKTHQDIEDVQLVVDFGLETDKGNYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLF 125
            .:.::     |:.:::.:|..:.|.             ||.|:.| ...:...:|:....:..|.
  Fly    72 QLRMR-----ENRRVLYNFDFKVDS-------------CKFMRDR-KHVIANWVYQTFGPYSNLN 117

  Fly   126 KECPIRSGTYSLTNYNVD-----------EEMLPSFLPEAKF 156
            ..||          |:.|           .:::.|.:|:.::
  Fly   118 HTCP----------YDHDIVLDKLPVQHLNKLVQSIIPDGRY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 12/81 (15%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 14/94 (15%)

Return to query results.
Submit another query.