DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG13589

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:67 Identity:16/67 - (23%)
Similarity:33/67 - (49%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNY-NVDEEMLPSFLPEA 154
            |.:.|.:.|:.|::|| .|..:.::..:....|:...||. .|...|::: ::|   :|..||..
  Fly    87 LFDYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPY-EGLQMLSDFHHID---VPVPLPSG 146

  Fly   155 KF 156
            .:
  Fly   147 DY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/67 (24%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 16/67 (24%)

Return to query results.
Submit another query.