DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33795

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:42/178 - (23%)
Similarity:69/178 - (38%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILVALMPLTGAWR-SFKVI--LTSIDFEA-NDKFLD-----LKVDLQNDSGESNLSIDIKTHQDI 70
            |:|.|:.....|| |:.|.  ||::..|: |..::.     ||...:|   .:..:.:...|...
  Fly     7 IVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRN---RTVFNFNATIHHPT 68

  Fly    71 EDVQLVVDFG-LETDKGNYSTLINRTLNFCKLMKQRNSDPLVRAI----------------YEDL 118
            .||  |:|:. |:.:.|....|..:.::.|:.:: :..|.|.:.|                |.|:
  Fly    69 NDV--VIDYRFLKRENGYKPWLYKKNIDGCRFLR-KPYDMLTKMIYMVFKPFSNINHTCPFYGDI 130

  Fly   119 LKHG----TLFKECPIRSGTYSL-------------TNYNVD--EEML 147
            |..|    |..|..|..||.|.|             ||.:.|  |.:|
  Fly   131 LIRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYDFIENLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 21/96 (22%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.