powered by:
Protein Alignment CG14455 and CG33725
DIOPT Version :9
Sequence 1: | NP_649402.2 |
Gene: | CG14455 / 40480 |
FlyBaseID: | FBgn0037175 |
Length: | 194 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027125.1 |
Gene: | CG33725 / 3772600 |
FlyBaseID: | FBgn0053725 |
Length: | 181 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 20/39 - (51%) |
Gaps: | 1/39 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECP 129
|::..|:.|:.:: .|..|.||.|::......|:...||
Fly 89 LLDVKLDACRFVR-TNFHPFVRIIFDLFKDFSTINHTCP 126
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14455 | NP_649402.2 |
DM8 |
87..179 |
CDD:214778 |
11/39 (28%) |
CG33725 | NP_001027125.1 |
DUF1091 |
74..154 |
CDD:284008 |
11/39 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45448122 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.