DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33658

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:143 Identity:32/143 - (22%)
Similarity:54/143 - (37%) Gaps:20/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSFKVILTSIDFEANDKFLDLK-VDLQNDSGE-------------SNLSIDIKTHQDIEDVQLVV 77
            |.:.:..|.....::.:|.:.| ..:..|..:             ..||..||..:.:.  .|.|
  Fly    13 RQYTIAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLN--SLKV 75

  Fly    78 DFGLETDKGNYST-LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTY--SLTN 139
            :|||......|.. |.|.|::.|:.||...|:.:.:..|:.:.....|...||......  .||:
  Fly    76 NFGLHQQINGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTS 140

  Fly   140 YNVDEEMLPSFLP 152
            ..::.. ||..||
  Fly   141 ETINSR-LPKTLP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 18/69 (26%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.