DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33769

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:140 Identity:41/140 - (29%)
Similarity:59/140 - (42%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NDSGESNLSIDIKTHQDIEDVQLVVDF--GLE---------TDKGNYSTLINRTLNFCKLMKQRN 106
            |.|..||.||.|...:.|.|:.||...  ||:         |....|.::....:|:|.|:| .:
  Fly    37 NRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIK-GS 100

  Fly   107 SDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPSFLPEAKFRFGMKISTDKGGMIV 171
            .:.:.|..:..:||.|.....||||.|.|.|..:.:|...:||||....:|            |.
  Fly   101 QESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANNVPSFLYLGDYR------------IS 153

  Fly   172 RSTIFGRIDK 181
            .|..:||..|
  Fly   154 GSFYYGRFKK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 25/91 (27%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.