DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33773

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:166 Identity:38/166 - (22%)
Similarity:64/166 - (38%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FKVILTSIDFE---ANDKFLDLKV-DLQNDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNY- 88
            :.:|.|:..||   .|....||:| :.:|    .||....::::.:.....:....|...|.|: 
  Fly    16 YSIIKTNSRFEFTNLNCTAFDLRVGEFEN----CNLKSINRSYKYVSGKYKLNQIPLPRMKVNFI 76

  Fly    89 ---------STLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSG------TYSLT 138
                     ..|.|.|.:.||.::...|:|:::.|::....:..:...||..|.      .....
  Fly    77 MWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDLIVERLPIGFM 141

  Fly   139 NYNVDEEMLPSFLPEAKFRFGMKISTDKGGMIVRST 174
            |..| .|:||  .||..:.|....|..|.  |..||
  Fly   142 NLRV-TEILP--FPEGNYLFEFHFSRRKS--IFAST 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 25/104 (24%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.