DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33771

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:166 Identity:31/166 - (18%)
Similarity:71/166 - (42%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FILVALMPLTGAWRSFKVILTSIDFEANDK-FLDLKVDLQNDSGESNLSID------IKTHQDIE 71
            |:||.|:..|........:..:.:...|.| |.:..:.:.|::...::.::      .|.|.||.
  Fly     8 FLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAHVDIL 72

  Fly    72 DVQLVVDFGLETDKGNYSTLINRTLNFCKLMKQ-RNSDPLVRAIYEDLLKHGTLFKECPIRSGTY 135
             ::|       .:..|:.::.::..:.|.:... :||  |.::.::|:.|:......||:..|.|
  Fly    73 -LRL-------ANAKNFQSMFSQKSDVCAVTSSVKNS--LFKSWFKDMSKNSNFMYNCPVEVGHY 127

  Fly   136 SLTNYNVDEEMLPSFLPEAKFR---------FGMKI 162
            .:.::.:...|...||...::|         :|.|:
  Fly   128 YMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/86 (20%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.