DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33792

DIOPT Version :9

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:135 Identity:26/135 - (19%)
Similarity:48/135 - (35%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTL-INRTLNFCKLMKQR-NSDPLVRAIYEDLLKH 121
            |:..|||  :.:.|:::.|:...:.....|... :....:.|:|:|.: .|:.|.:.....|.:.
  Fly    63 NMDGDIK--EALTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEW 125

  Fly   122 GTLFKECPIR----------------------SGTYSLTNYNVDEEMLPSFLPEAKFRFGMKIST 164
            ..:...||.|                      .|.....|:.:||..|| .||...::.....|.
  Fly   126 TNVNHSCPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLP-ILPIQDYKIAFNFSG 189

  Fly   165 DKGGM 169
            ...|:
  Fly   190 ANPGI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 20/107 (19%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.