DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33775

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:77 Identity:15/77 - (19%)
Similarity:32/77 - (41%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPSF-LPEA 154
            |.|.:.:.|:|:...|:......:...:.|...|...||...... :.|....::.|.:. ||:.
  Fly    93 LYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDII-VDNMEFSDDFLKTLPLPQG 156

  Fly   155 KFRFGMKISTDK 166
            .::..::.:|.|
  Fly   157 VYKIQLRFATYK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 15/77 (19%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 13/67 (19%)

Return to query results.
Submit another query.