DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33796

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:103 Identity:20/103 - (19%)
Similarity:37/103 - (35%) Gaps:38/103 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DKGNYSTLINRTLNFCKLMKQ-------------RN-----------SDPLVRAIY--EDLLKHG 122
            :.|....|:|..::.|:.:::             ||           .|.:||.:|  .|:::  
  Fly    82 ENGYRPWLVNTQIDGCRFLRKPYDALGILLFNIYRNFTNINHTCPLQGDMIVRNMYLTTDVMR-- 144

  Fly   123 TLFKECPIRSGTYSLTNYNVDEEML--PSFLPEAKFRF 158
                 .|:.:|.|.|.   :|....  |.|.....|:|
  Fly   145 -----LPLPTGDYLLA---IDWIFYGKPQFATNVSFQF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 19/100 (19%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 14/78 (18%)

Return to query results.
Submit another query.