DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14455 and CG33920

DIOPT Version :10

Sequence 1:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:174 Identity:31/174 - (17%)
Similarity:65/174 - (37%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IRSCCAVAFIL--VALMPLTGAWRSFKVILTSIDFEAND-------------KFLDLKVDLQNDS 55
            :..|..||.:.  ::::.::..:....::..|:|.:.:|             |::.:|..|    
  Fly     3 VNHCGLVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKL---- 63

  Fly    56 GESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLK 120
                    .||  .|..:..|:........|....:.|.||:.|:.|....|:|:...:|:.:..
  Fly    64 --------FKT--PITKINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRP 118

  Fly   121 HGTLFKECP------IRSGTYSLTNYNVDEEMLPSFLPEAKFRF 158
            ...:...||      |........|:.| .::||  :||..:.:
  Fly   119 FTNMNHNCPYDHDLVIEKLPIHFVNHQV-TKVLP--VPEGDYLY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/78 (22%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 19/89 (21%)

Return to query results.
Submit another query.